Structure of PDB 4xln Chain F

Receptor sequence

>4xlnF (length=347) Species: 271 (Thermus aquaticus)

TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQEL
IREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHI
AREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEK
FEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTAR
QLQQELGREPSYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKD
SFYGDFIPDENLPSPVEAAAQSLLSEELEKALSKLSEREAMVLKLRKGLI
DGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE

3D structure

• PDB: 4xln Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
• Chain: F
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	V96 R97 L100 H101 L108 N206 R208 L209 S212 K215 F224 R237 K241 F242 E243 R246 F248 K249 S251 T252 Y253 T255 W256 W257 Q260 R264 R274 P276 V277 H278 R379 V407 T408 R411 Q414	V5 R6 L9 H10 L17 N115 R117 L118 S121 K124 F133 R146 K150 F151 E152 R155 F157 K158 S160 T161 Y162 T164 W165 W166 Q169 R173 R183 P185 V186 H187 R288 V316 T317 R320 Q323
BS02	dna	F	R220 R259 Q260 N263 R271 E281 S287 R288 R291 A326 I336 E339 F347 T397 L398 R409 E410 R413	R129 R168 Q169 N172 R180 E190 S196 R197 R200 A235 I245 E248 F256 T306 L307 R318 E319 R322
BS03	rna	F	D338 E339	D247 E248

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:4xln, PDBe:4xln, PDBj:4xln
• PDBsum: 4xln
• PubMed: 26349032
• UniProt: Q9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)