Structure of PDB 4ueq Chain F

Receptor sequence

>4ueqF (length=261) Species: 596151 (Solidesulfovibrio fructosivorans JJ]) [Search protein sequence]

KHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAG
EAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAA
KAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPIN
FVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFD
SEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDF
WDTMTPFYEQG

3D structure

PDB

4ueq [NiFe]-hydrogenases revisited: nickel-carboxamido bond formation in a variant with accrued O2-tolerance and a tentative re-interpretation of Ni-SI states.

Chain

Resolution

1.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C17 C20 C114 C147 H184 C187 C212 C218 C227 P238 C245 C248
Catalytic site (residue number reindexed from 1)	C14 C17 C111 C144 H181 C184 C209 C215 C224 P235 C242 C245
Enzyme Commision number	1.12.2.1: cytochrome-c3 hydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	F	H184 C187 R189 L190 C212 L213 Y214 C218 P221	H181 C184 R186 L187 C209 L210 Y211 C215 P218
BS02	F3S	F	N225 C227 F232 W237 P238 C245 L246 C248	N222 C224 F229 W234 P235 C242 L243 C245
BS03	SF4	F	E16 C17 G19 C20 G112 C114 C147 P148	E13 C14 G16 C17 G109 C111 C144 P145
BS04	CO3	F	K122 D252	K119 D249

Gene Ontology

	Molecular Function
GO:0008901	ferredoxin hydrogenase activity
GO:0051536	iron-sulfur cluster binding

	Cellular Component
GO:0009375	ferredoxin hydrogenase complex

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4ueq, PDBe:4ueq, PDBj:4ueq
PDBsum	4ueq
PubMed	25780984
UniProt	E1K248

[Back to BioLiP]