Structure of PDB 4tv9 Chain F

Receptor sequence

>4tv9F (length=338) Species: 9031 (Gallus gallus)

MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFG
RLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYVI
YPTNLTDEREVFLAAYNRGNVWIAKSSEGILISSEASELLDFIDEQGQVH
VIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPYNS
ANFQDKTCHLTNHCIQKEYSKNYGRYEEGNEMFFEEFNQYLMDALNTTLE
NSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLI
EVNGAPACAQKLYAELCQGIVDVAISSVFPLASIFIKL

3D structure

• PDB: 4tv9 A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.
• Chain: F
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACP	F	K74 I148 K150 Q183 K184 Y185 L186 K198 R222 T241 N242 D318 E331	K74 I123 K125 Q153 K154 Y155 L156 K168 R192 T211 N212 D288 E301

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 18:46:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4tv9', asym_id = 'F', title = 'A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4tv9', asym_id='F', title='A new tubulin-binding site and pharmacophore for microtubule-destabilizing anticancer drugs.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0036211', uniprot = '', pdbid = '4tv9', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0036211', uniprot='', pdbid='4tv9', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>