Structure of PDB 4q66 Chain F

Receptor sequence
>4q66F (length=146) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MRILMVGLDGAGKTTVLYKLKPTIGFNVETVQYKFTVWDVGGLDRIRSLW
RHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQ
DLPEAMSAAEITEKLGLHSIRPWFIQATCATSGEGLYEGLEWLSNS
3D structure
PDB4q66 Structural basis for membrane binding and remodeling by the exomer secretory vesicle cargo adaptor.
ChainF
Resolution3.354 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP F D26 G27 G29 K30 T31 T32 P47 T48 N126 K127 D129 L130 C159 A160 T161 D9 G10 G12 K13 T14 T15 P22 T23 N98 K99 D101 L102 C129 A130 T131
BS02 MG F T31 T48 T14 T23
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006893 Golgi to plasma membrane transport
GO:0010636 positive regulation of mitochondrial fusion
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0016236 macroautophagy
GO:0019217 regulation of fatty acid metabolic process
GO:0048193 Golgi vesicle transport
GO:0090141 positive regulation of mitochondrial fission
GO:1903292 protein localization to Golgi membrane
GO:1903358 regulation of Golgi organization
Cellular Component
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0044232 organelle membrane contact site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4q66, PDBe:4q66, PDBj:4q66
PDBsum4q66
PubMed25203211
UniProtP11076|ARF1_YEAST ADP-ribosylation factor 1 (Gene Name=ARF1)

[Back to BioLiP]