Structure of PDB 4oor Chain F

Receptor sequence

>4oorF (length=70) Species: 32630 (synthetic construct)

QKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGHNYLCAGRNDCIIDKI
RRKNCPACRLRKCLQAGMTL

3D structure

• PDB: 4oor Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.
• Chain: F
• Resolution: 2.701 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	C17 Y19 K32	C14 Y16 K29
BS02	dna	F	S26 R33 R56 K57 R63	S23 R30 R52 K53 R59
BS03	ZN	F	C43 C49 C59 C62	C39 C45 C55 C58
BS04	ZN	F	C7 C27	C4 C24

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 06:56:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4oor', asym_id = 'F', title = 'Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4oor', asym_id='F', title='Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003700,0006355,0008270,0043565', uniprot = '', pdbid = '4oor', asym_id = 'F'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003700,0006355,0008270,0043565', uniprot='', pdbid='4oor', asym_id='F')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>