Structure of PDB 4n78 Chain F

Receptor sequence
>4n78F (length=156) Species: 9606 (Homo sapiens) [Search protein sequence]
AMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEE
TKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDI
HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDI
GHGVKW
3D structure
PDB4n78 The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
ChainF
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F R106 G110 R107 G111
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008093 cytoskeletal anchor activity
GO:0017124 SH3 domain binding
GO:0019900 kinase binding
GO:0031267 small GTPase binding
GO:0031625 ubiquitin protein ligase binding
GO:0035591 signaling adaptor activity
GO:0042802 identical protein binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000423 mitophagy
GO:0001764 neuron migration
GO:0007010 cytoskeleton organization
GO:0007399 nervous system development
GO:0008154 actin polymerization or depolymerization
GO:0010592 positive regulation of lamellipodium assembly
GO:0016477 cell migration
GO:0016601 Rac protein signal transduction
GO:0018108 peptidyl-tyrosine phosphorylation
GO:0061001 regulation of dendritic spine morphogenesis
GO:0070309 lens fiber cell morphogenesis
GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005912 adherens junction
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031209 SCAR complex
GO:0032433 filopodium tip
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0070161 anchoring junction
GO:0098858 actin-based cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4n78, PDBe:4n78, PDBj:4n78
PDBsum4n78
PubMed24439376
UniProtQ9NYB9|ABI2_HUMAN Abl interactor 2 (Gene Name=ABI2)

[Back to BioLiP]