Structure of PDB 4m9v Chain F

Receptor sequence
>4m9vF (length=60) Species: 10090 (Mus musculus) [Search protein sequence]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVN
RHLKVHQNKP
3D structure
PDB4m9v DNA recognition of 5-carboxylcytosine by a zfp57 mutant at an atomic resolution of 0.97 angstrom.
ChainF
Resolution0.969 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F S156 R157 R159 R160 S181 Q182 S22 R23 R25 R26 S47 Q48 PDBbind-CN: Kd=7nM
BS02 dna F R138 Y149 R150 D151 S153 R166 K175 R178 Q182 R185 H186 V189 R4 Y15 R16 D17 S19 R32 K41 R44 Q48 R51 H52 V55 PDBbind-CN: Kd=7nM
BS03 ZN F C170 C173 H186 H190 C36 C39 H52 H56
BS04 ZN F C142 C145 H158 H162 C8 C11 H24 H28
External links
PDB RCSB:4m9v, PDBe:4m9v, PDBj:4m9v
PDBsum4m9v
PubMed24236546
UniProtQ8C6P8|ZFP57_MOUSE Zinc finger protein 57 (Gene Name=Zfp57)

[Back to BioLiP]