Structure of PDB 4lmx Chain F

Receptor sequence

>4lmxF (length=176) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

LDAFSKVITSADGKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCI
VSDSVSGMVCENPSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGD
SSVLEDRCLNGLKETYASLGVPAAGNARTISIMKATVIGFITNNSQQKKL
STPAGDCSALASEVGGYFDKVSSALA

3D structure

PDB

4lmx Single-residue insertion switches the quaternary structure and exciton states of cryptophyte light-harvesting proteins.

Chain

Resolution

1.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	DBV	F	C50 D54 S57 G58 C61 R129 I133 A136 T137 F141 S146 Q148 K149	C49 D53 S56 G57 C60 R128 I132 A135 T136 F140 S145 Q147 K148
BS02	PEB	F	K28 N35 K36 M38 D39 I142 T153 P154 G156 C158	K27 N34 K35 M37 D38 I141 T152 P153 G155 C157
BS03	PEB	F	M59 G72 A81 C82 R84 D85 I88 L120 V122 P123 N127	M58 G71 A80 C81 R83 D84 I87 L119 V121 P122 N126

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4lmx, PDBe:4lmx, PDBj:4lmx
PDBsum	4lmx
PubMed	24979784
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]