Structure of PDB 4ioa Chain F

Receptor sequence
>4ioaF (length=71) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAA
ANTVAGTARSMGVTVEGGPNA
3D structure
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainF
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F M74 R79 K86 S88 S89 T90 P91 N92 A117 T126 G129 R132 S133 M134 M1 R6 K13 S15 S16 T17 P18 N19 A44 T53 G56 R59 S60 M61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RSS7|RL11_DEIRA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]