Structure of PDB 4il6 Chain F

Receptor sequence
>4il6F (length=34) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
3D structure
PDB4il6 Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
ChainF
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM F R19 W20 V23 H24 A27 R8 W9 V12 H13 A16
Gene Ontology
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4il6, PDBe:4il6, PDBj:4il6
PDBsum4il6
PubMed23426624
UniProtP12239|PSBF_THEVL Cytochrome b559 subunit beta (Gene Name=psbF)

[Back to BioLiP]