Structure of PDB 4gyd Chain F

Receptor sequence
>4gydF (length=86) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
ADSVNGAKIFSANCASCHAGGKNLVQAQKTLKKADLEKYGMYSAEAIIAQ
VTNGKNAMPAFKGRLKPEQIEDVAAYVLGKADADWK
3D structure
PDB4gyd The dynamic complex of cytochrome c6 and cytochrome f studied with paramagnetic NMR spectroscopy
ChainF
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEC F N13 C14 C17 H18 N23 K29 T30 L31 D35 L36 Y39 Q50 V51 K55 N56 M58 P59 F61 N13 C14 C17 H18 N23 K29 T30 L31 D35 L36 Y39 Q50 V51 K55 N56 M58 P59 F61
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4gyd, PDBe:4gyd, PDBj:4gyd
PDBsum4gyd
PubMed24685428
UniProtP0A3X7|CYC6_NOSS1 Cytochrome c6 (Gene Name=petJ)

[Back to BioLiP]