Structure of PDB 4gyd Chain F

Receptor sequence

>4gydF (length=86) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

ADSVNGAKIFSANCASCHAGGKNLVQAQKTLKKADLEKYGMYSAEAIIAQ
VTNGKNAMPAFKGRLKPEQIEDVAAYVLGKADADWK

3D structure

• PDB: 4gyd The dynamic complex of cytochrome c6 and cytochrome f studied with paramagnetic NMR spectroscopy
• Chain: F
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	F	N13 C14 C17 H18 N23 K29 T30 L31 D35 L36 Y39 Q50 V51 K55 N56 M58 P59 F61	N13 C14 C17 H18 N23 K29 T30 L31 D35 L36 Y39 Q50 V51 K55 N56 M58 P59 F61

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0031977 thylakoid lumen
• GO:0031979 plasma membrane-derived thylakoid lumen

External links

• PDB: RCSB:4gyd, PDBe:4gyd, PDBj:4gyd
• PDBsum: 4gyd
• PubMed: 24685428
• UniProt: P0A3X7|CYC6_NOSS1 Cytochrome c6 (Gene Name=petJ)