Structure of PDB 4chg Chain F |
>4chgF (length=133) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
AMIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTD EDTAALRRRLLQRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQV AAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF |
|
PDB | 4chg Crystal Structure of the Vapbc-15 Complex from Mycobacterium Tuberculosis Reveals a Two-Metal Ion Dependent Pin-Domain Ribonuclease And a Variable Mode of Toxin-Antitoxin Assembly. |
Chain | F |
Resolution | 2.1 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
F |
D96 D114 D116 |
D97 D115 D117 |
|
|
|
|