Structure of PDB 4cdc Chain F |
>4cdcF (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] |
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGT DECAIESIAVAATPIPKL |
|
PDB | 4cdc Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate. |
Chain | F |
Resolution | 2.4 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H381 N403 |
Catalytic site (residue number reindexed from 1) |
H10 N32 |
Enzyme Commision number |
3.4.14.1: dipeptidyl-peptidase I. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6AO |
F |
N380 H381 |
N9 H10 |
|
|
|
|