Structure of PDB 3zyb Chain F

Receptor sequence
>3zybF (length=121) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREH
PDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYND
VPGTYGNNSGSFSVNIGKDQS
3D structure
PDB3zyb A Glycopeptide Dendrimer Inhibitor of the Galactose-Specific Lectin Leca and of Pseudomonas Aeruginosa Biofilms.
ChainF
Resolution2.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F E49 H50 P51 E49 H50 P51
BS02 GAL F E11 P102 G103 E11 P102 G103
BS03 CA F Y36 D100 T104 N107 N108 Y36 D100 T104 N107 N108
BS04 GAL F Y36 H50 Q53 D100 T104 Y36 H50 Q53 D100 T104
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding
Biological Process
GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
Cellular Component
GO:0005737 cytoplasm
GO:0009986 cell surface
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3zyb, PDBe:3zyb, PDBj:3zyb
PDBsum3zyb
PubMed21919164
UniProtQ05097|PA1L_PSEAE PA-I galactophilic lectin (Gene Name=lecA)

[Back to BioLiP]