Structure of PDB 3zwm Chain F

Receptor sequence

>3zwmF (length=253) Species: 6500 (Aplysia californica)

AAIVPTRELENVFLGRCKDYEITRYLDILPRVRSDCSALWKDFFKAFSFK
NPCDLDLGSYKDFFTSAQQQLPKNKVMFWSGVYDEAHDYANTGRKYITLE
DTLPGYMLNSLVWCGQRANPGFNEKVCPDFKTCPVQARESFWGMASSSYA
HSAEGEVTYMVDGSNPKVPAYRPDSFFGKYELPNLTNKVTRVKVIVLHRL
GEKIIEKCGAGSLLDLEKLVKAKHFAFDCVENPRAVLFLLCSDNPNAREC
RLA

3D structure

• PDB: 3zwm Structural Studies of Intermediates Along the Cyclization Pathway of Aplysia Adp-Ribosyl Cyclase.
• Chain: F
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E98 F174 E179
• Catalytic site (residue number reindexed from 1): E100 F176 E181
• Enzyme Commision number: 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
  3.2.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CXR	F	F76 W77 S78 G79 L97 F128 W140 S144 S173 F174 E179	F78 W79 S80 G81 L99 F130 W142 S146 S175 F176 E181

Gene Ontology

Molecular Function

• GO:0003953 NAD+ nucleosidase activity
• GO:0016740 transferase activity
• GO:0016787 hydrolase activity
• GO:0016849 phosphorus-oxygen lyase activity
• GO:0061809 NAD+ nucleotidase, cyclic ADP-ribose generating

Biological Process

• GO:0007338 single fertilization
• GO:0030890 positive regulation of B cell proliferation

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:3zwm, PDBe:3zwm, PDBj:3zwm
• PDBsum: 3zwm
• PubMed: 22138343
• UniProt: P29241|NADA_APLCA ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase