Structure of PDB 3vpb Chain F |
>3vpbF (length=56) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search protein sequence] |
MVVLKCPVCNGDVNVPDDALPGEIVEHECGAQLEVYNDHGRLALRLAEQV GEDWGE |
|
PDB | 3vpb Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus |
Chain | F |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
F |
C6 C9 H27 C29 |
C6 C9 H27 C29 |
|
|
|
|