Structure of PDB 3uom Chain F

Receptor sequence

>3uomF (length=350) Species: 9606 (Homo sapiens) [Search protein sequence]

DFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEME
ELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDEVI
EYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKS
KDSEHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEE
PVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAF
AEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFD
IDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTE

3D structure

PDB

3uom High-capacity Ca2+ Binding of Human Skeletal Calsequestrin.

Chain

Resolution

2.02 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	F	E128 L129 E135	E124 L125 E131
BS02	CA	F	D306 S308	D302 S304
BS03	CA	F	D259 D261	D255 D257
BS04	CA	F	D245 D247 I249	D241 D243 I245
BS05	CA	F	D261 E264	D257 E260
BS06	CA	F	N17 V18 D80	N13 V14 D76
BS07	CA	F	D210 P212 E217	D206 P208 E213
BS08	CA	F	E199 T229	E195 T225
BS09	CA	F	E337 E340	E333 E336
BS10	CA	F	E337 D341	E333 D337

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0007029	endoplasmic reticulum organization
GO:0007519	skeletal muscle tissue development
GO:0009408	response to heat
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0014809	regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
GO:0014870	response to muscle inactivity
GO:0014894	response to denervation involved in regulation of muscle adaptation
GO:0045214	sarcomere organization
GO:0051258	protein polymerization
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol
GO:0051282	regulation of sequestering of calcium ion
GO:1901341	positive regulation of store-operated calcium channel activity
GO:2001256	regulation of store-operated calcium entry

	Cellular Component
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005783	endoplasmic reticulum
GO:0005790	smooth endoplasmic reticulum
GO:0014802	terminal cisterna
GO:0014804	terminal cisterna lumen
GO:0016020	membrane
GO:0016529	sarcoplasmic reticulum
GO:0030016	myofibril
GO:0030018	Z disc
GO:0030315	T-tubule
GO:0031674	I band
GO:0033017	sarcoplasmic reticulum membrane
GO:0033018	sarcoplasmic reticulum lumen
GO:0042383	sarcolemma

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3uom, PDBe:3uom, PDBj:3uom
PDBsum	3uom
PubMed	22337878
UniProt	P31415\|CASQ1_HUMAN Calsequestrin-1 (Gene Name=CASQ1)

[Back to BioLiP]