Structure of PDB 3u52 Chain F |
>3u52F (length=118) Species: 316 (Stutzerimonas stutzeri) [Search protein sequence] |
SVNALYDYKFEPKDKVENFHGMQLLYVYWPDHLLFCAPFALLVQPGMTFS ALVDEILKPATAAHPDSAKADFLNAEWLLNDEPFTPKADASLKEQGIDHK SMLTVTTPGLKGMANAGY |
|
PDB | 3u52 Analysis of Substrate Access to Active Sites in Bacterial Multicomponent Monooxygenase Hydroxylases: X-ray Crystal Structure of Xenon-Pressurized Phenol Hydroxylase from Pseudomonas sp. OX1. |
Chain | F |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GOL |
F |
A5 Y7 Y9 |
A4 Y6 Y8 |
|
|
|
|