Structure of PDB 3tmk Chain F

Receptor sequence

>3tmkF (length=216) Species: 4932 (Saccharomyces cerevisiae)

MMGRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLIN
EYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYVYSGV
AYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQDVDNNAEKSGFGDER
YETVKFQEKVKQTFMKLLDKEIRKGDESITIVDVTNKGIQEVEALIWQIV
EPVLSTHIDHDKFSFF

3D structure

• PDB: 3tmk Crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-thymidyl) pentaphosphate (TP5A) at 2.0 A resolution: implications for catalysis and AZT activation.
• Chain: F
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.9: dTMP kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	T5A	F	D14 R15 T16 G17 K18 T19 T20 K37 F38 P39 R41 L53 F69 R73 R94 G99 Y102 K143 Y151 K187 G188 I189	D14 R15 T16 G17 K18 T19 T20 K37 F38 P39 R41 L53 F69 R73 R94 G99 Y102 K143 Y151 K187 G188 I189	MOAD: Kd=135nM

Gene Ontology

Molecular Function

• GO:0004550 nucleoside diphosphate kinase activity
• GO:0004798 thymidylate kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0009041 UMP/dUMP kinase activity
• GO:0016301 kinase activity

Biological Process

• GO:0006227 dUDP biosynthetic process
• GO:0006233 dTDP biosynthetic process
• GO:0006235 dTTP biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0016310 phosphorylation
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:3tmk, PDBe:3tmk, PDBj:3tmk
• PDBsum: 3tmk
• PubMed: 9521686
• UniProt: P00572|KTHY_YEAST Thymidylate kinase (Gene Name=CDC8)