Structure of PDB 3s0p Chain F |
>3s0pF (length=123) Species: 4081 (Solanum lycopersicum) [Search protein sequence] |
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYG DTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGR ALVVHELEDGGRLACGVVGLTPI |
|
PDB | 3s0p Biophysical properties of Tomato Chloroplast SOD |
Chain | F |
Resolution | 3.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
F |
H46 H48 H120 |
H45 H47 H105 |
|
|
|
|