Structure of PDB 3qtk Chain F |
>3qtkF (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN DEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD |
|
PDB | 3qtk Total chemical synthesis of biologically active vascular endothelial growth factor. |
Chain | F |
Resolution | 1.849 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
TFA |
F |
P46 Q91 |
P41 Q86 |
|
|
|
|