Structure of PDB 3p70 Chain F

Receptor sequence

>3p70F (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERIEKISMLEKIYIHPRYNWRENLDRDIA
LMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTKG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
QF

3D structure

• PDB: 3p70 Structural basis of thrombin-mediated factor V activation: the Glu666-Glu672 sequence is critical for processing at the heavy chain-B domain junction.
• Chain: F
• Resolution: 2.55 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H406 D462 E565 G566 D567 S568 G569
• Catalytic site (residue number reindexed from 1): H43 D98 E197 G198 D199 S200 G201
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	F	E371 I372 M374 P376 W377 H479 P480 V481 C482 Y497 K498 G499 R500 N527 K575 R581 W582	E8 I9 M11 P13 W14 H115 P116 V117 C118 Y133 K134 G135 R136 N159 K207 R213 W214
BS02	peptide	F	W413 W511	W50 W147
BS03	peptide	F	F382 R431 T432 R433 Y434	F19 R68 T69 R70 Y71
BS04	BEN	F	D562 A563 C564 E565 V588 W590 C594	D194 A195 C196 E197 V220 W222 C226
BS05	BGC	F	R533 H605	R165 H237

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:3p70, PDBe:3p70, PDBj:3p70
• PDBsum: 3p70
• PubMed: 21555742
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)