Structure of PDB 3mxg Chain F |
>3mxgF (length=70) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] |
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLLSAQLTGMTVT IKSSTCESGSGFAEVQFNND |
|
PDB | 3mxg Molecular basis of differential B-pentamer stability of Shiga toxins 1 and 2. |
Chain | F |
Resolution | 2.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
XLS |
F |
D16 W29 |
D16 W29 |
|
|
|
|