Structure of PDB 3mgn Chain F

Receptor sequence
>3mgnF (length=45) [Search protein sequence]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
3D structure
PDB3mgn Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
ChainF
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F V34 I37 K38 Q41 L45 V34 I37 K38 Q41 L45
BS02 peptide F L32 W35 G36 Q39 L40 R43 L32 W35 G36 Q39 L40 R43
External links