Structure of PDB 3jam Chain F

Receptor sequence

>3jamF (length=206) Species: 28985 (Kluyveromyces lactis)

FVPVELATTIPVEIQQAQQEIKLFNKWSFEDVEVKDASLVDYIQISKPIY
VAHTAGRYANKRFRKAQCPIVERLTNSLMMNGRNNGKKLKAVRIVKHTLE
IINVLTDQNPLQVVVDAIINSGPREDTTRVGGGGAARRQAVDVSPLRRVN
QSIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

• PDB: 3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
• Chain: F
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	H74 R78 A80 N81 K82 R83 K86 N97 L99 M100 M101 N102 G103 R104 N105 N106 K108 K109 L110 K111 R114 R168 N171 R182 R187 N188 I189 T191 I192	H53 R57 A59 N60 K61 R62 K65 N76 L78 M79 M80 N81 G82 R83 N84 N85 K87 K88 L89 K90 R93 R147 N150 R161 R166 N167 I168 T170 I171

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jam, PDBe:3jam, PDBj:3jam
• PDBsum: 3jam
• PubMed: 26212456
• UniProt: Q6CRA3