Structure of PDB 3j5s Chain F

Receptor sequence

>3j5sF (length=234) Species: 562 (Escherichia coli)

MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN

3D structure

• PDB: 3j5s EttA regulates translation by binding the ribosomal E site and restricting ribosome-tRNA dynamics.
• Chain: F
• Resolution: 7.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	M1 K3 R7 M8 R9 V10 I11 R12 T18 T35 A36 K37 F38 S41 D43 R71 R74 K105 K106 M109 L127 V130 L131 G132 P133 R134 G135 L136 M137 R162 R164 D166 K167 N168 I170 H172 T174 K211 S213 S215 T217 M218 A220	M1 K3 R7 M8 R9 V10 I11 R12 T18 T35 A36 K37 F38 S41 D43 R71 R74 K105 K106 M109 L127 V130 L131 G132 P133 R134 G135 L136 M137 R162 R164 D166 K167 N168 I170 H172 T174 K211 S213 S215 T217 M218 A220

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j5s, PDBe:3j5s, PDBj:3j5s
• PDBsum: 3j5s
• PubMed: 24389465
• UniProt: P0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)