Structure of PDB 3hf4 Chain F

Receptor sequence

>3hf4F (length=146) Species: 10116 (Rattus norvegicus) [Search protein sequence]

VHLTDAEKAAVNGLWGKVNPDDVGGEALGRLLVVYPWTQRYFDSFGDLSS
ASAIMGNPKVKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDP
ENFRLLGNMIVIVLGHHLGKEFTPCAQAAFQKVVAGVASALAHKYH

3D structure

PDB

3hf4 Quaternary structural variability in rat hemoglobin

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	F	Y41 F42 H63 K66 V67 L88 H92 L96 V98 N102 F103 L106 L141	Y41 F42 H63 K66 V67 L88 H92 L96 V98 N102 F103 L106 L141

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0005344	oxygen carrier activity
GO:0019825	oxygen binding
GO:0020037	heme binding
GO:0030492	hemoglobin binding
GO:0031720	haptoglobin binding
GO:0031721	hemoglobin alpha binding
GO:0031722	hemoglobin beta binding
GO:0043177	organic acid binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0006749	glutathione metabolic process
GO:0015670	carbon dioxide transport
GO:0015671	oxygen transport
GO:0030097	hemopoiesis
GO:0030185	nitric oxide transport
GO:0042542	response to hydrogen peroxide
GO:0042744	hydrogen peroxide catabolic process
GO:0048821	erythrocyte development
GO:0070293	renal absorption
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005615	extracellular space
GO:0005833	hemoglobin complex
GO:0031838	haptoglobin-hemoglobin complex

External links

PDB	RCSB:3hf4, PDBe:3hf4, PDBj:3hf4
PDBsum	3hf4
PubMed
UniProt	P02091\|HBB1_RAT Hemoglobin subunit beta-1 (Gene Name=Hbb)