Structure of PDB 3gyx Chain F

Receptor sequence
>3gyxF (length=166) Species: 879 (Megalodesulfovibrio gigas) [Search protein sequence]
PTYVDPSKCDGCKGGEKTACMYICPNDLMILDPEEMKAFNQEPEACWECY
SCIKICPQGAITARPYADFAPMGGTCIPLRGSEDIMWTIKFRNGSVKRFK
FPIRTTPEGSIKPFEGKPEAGDLENELLFTETALTVPQVALGQKAQIADA
ETSQCWFDLPCEGGNR
3D structure
PDB3gyx Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit
ChainF
Resolution3.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) W48
Catalytic site (residue number reindexed from 1) W47
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 F C25 P26 L29 M30 C47 C50 Y51 C53 C24 P25 L28 M29 C46 C49 Y50 C52
BS02 SF4 F C10 G12 C13 C21 A39 C57 P58 I62 C9 G11 C12 C20 A38 C56 P57 I61
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0019420 dissimilatory sulfate reduction
GO:0051290 protein heterotetramerization
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gyx, PDBe:3gyx, PDBj:3gyx
PDBsum3gyx
PubMed19820092
UniProtT2G899|APRB_MEGG1 Adenylylsulfate reductase subunit beta (Gene Name=aprB)

[Back to BioLiP]