Structure of PDB 3ghg Chain F

Receptor sequence
>3ghgF (length=382) Species: 9606 (Homo sapiens) [Search protein sequence]
RFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKA
IQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEI
YNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQ
SGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKE
GFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYA
MFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFS
TWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGY
DNGIIWATWKTRWYSMKKTTMKIIPFNRLTIG
3D structure
PDB3ghg Crystal structure of human fibrinogen.
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F F295 T305 F322 Q329 D330 K338 C339 H340 Y363 D364 F282 T292 F309 Q316 D317 K325 C326 H327 Y350 D351
BS02 CA F D318 D320 F322 E323 G324 D305 D307 F309 E310 G311
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005198 structural molecule activity
GO:0005201 extracellular matrix structural constituent
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0050839 cell adhesion molecule binding
Biological Process
GO:0007160 cell-matrix adhesion
GO:0007596 blood coagulation
GO:0009306 protein secretion
GO:0030168 platelet activation
GO:0031639 plasminogen activation
GO:0034116 positive regulation of heterotypic cell-cell adhesion
GO:0036345 platelet maturation
GO:0042730 fibrinolysis
GO:0045907 positive regulation of vasoconstriction
GO:0045921 positive regulation of exocytosis
GO:0050714 positive regulation of protein secretion
GO:0051258 protein polymerization
GO:0051592 response to calcium ion
GO:0065003 protein-containing complex assembly
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070527 platelet aggregation
GO:0071347 cellular response to interleukin-1
GO:0071354 cellular response to interleukin-6
GO:0072378 blood coagulation, fibrin clot formation
GO:0090277 positive regulation of peptide hormone secretion
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000352 negative regulation of endothelial cell apoptotic process
Cellular Component
GO:0005576 extracellular region
GO:0005577 fibrinogen complex
GO:0005615 extracellular space
GO:0005788 endoplasmic reticulum lumen
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0031091 platelet alpha granule
GO:0031093 platelet alpha granule lumen
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ghg, PDBe:3ghg, PDBj:3ghg
PDBsum3ghg
PubMed19296670
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]