Structure of PDB 3fpv Chain F |
>3fpvF (length=141) Species: 1926 (Streptomyces reticuli) [Search protein sequence] |
VAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLV TLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLF LAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVLGH |
|
PDB | 3fpv The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase |
Chain | F |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
F |
Q75 S79 |
Q60 S64 |
|
|
|