Structure of PDB 3e3q Chain F |
>3e3qF (length=111) Species: 10090 (Mus musculus) [Search protein sequence] |
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSY GAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLY FGAGTRLSVLS |
|
PDB | 3e3q Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation. |
Chain | F |
Resolution | 2.95 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
F |
N30 Y50 G96 G97 |
N30 Y50 G95 G96 |
|
|
|