Structure of PDB 3a01 Chain F

Receptor sequence
>3a01F (length=61) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN
RRAKWRKQEKV
3D structure
PDB3a01 Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
ChainF
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F W140 K145 W55 K60
BS02 dna F R87 R89 T90 F92 N135 K139 R2 R4 T5 F7 N50 K54
BS03 dna F R87 R89 Y109 V112 Q134 R137 R141 R2 R4 Y24 V27 Q49 R52 R56
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3a01, PDBe:3a01, PDBj:3a01
PDBsum3a01
PubMed20389279
UniProtQ06453|AL_DROME Homeobox protein aristaless (Gene Name=al)

[Back to BioLiP]