Structure of PDB 2zjp Chain F

Receptor sequence
>2zjpF (length=144) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGD
AIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLN
WDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
3D structure
PDB2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
ChainF
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F A20 P21 P25 Q29 A20 P21 P25 Q29
BS02 rna F K9 L10 Q11 K86 S88 S89 P91 N92 K93 N116 A117 A122 N125 T126 G129 T130 S133 K9 L10 Q11 K86 S88 S89 P91 N92 K93 N116 A117 A122 N125 T126 G129 T130 S133
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
PDBsum2zjp
PubMed18406324
UniProtQ9RSS7|RL11_DEIRA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]