Structure of PDB 2ykr Chain F

Receptor sequence
>2ykrF (length=100) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS
3D structure
PDB2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
ChainF
Resolution9.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R2 Y4 Y49 I51 N52 K53 Q68 I71 D72 E75 R79 R86 M88 V89 M90 R91 K93 H94 R2 Y4 Y49 I51 N52 K53 Q68 I71 D72 E75 R79 R86 M88 V89 M90 R91 K93 H94
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum2ykr
PubMed21788480
UniProtP02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]