Structure of PDB 2xzw Chain F

Receptor sequence

>2xzwF (length=108) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805)

MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYTVEF
LQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTG
EKNADAIS

3D structure

• PDB: 2xzw Mechanism of 2-Oxoglutarate Signaling by the Synechococcus Elongatus Pii Signal Transduction Protein.
• Chain: F
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	F	G27 T29 I63 V64 R101 R103	G27 T29 I58 V59 R96 R98
BS02	ATP	F	I7 G35 F36 G37 R38 Q39 I86 G87 G89 K90 F92	I7 G35 F36 G37 R38 Q39 I81 G82 G84 K85 F87
BS03	AKG	F	G37 Q39 G41 L56 K58 G87	G37 Q39 G41 L51 K53 G82

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0030234 enzyme regulator activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006808 regulation of nitrogen utilization

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2xzw, PDBe:2xzw, PDBj:2xzw
• PDBsum: 2xzw
• PubMed: 21041661
• UniProt: P0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)