Structure of PDB 2xm3 Chain F

Receptor sequence
>2xm3F (length=126) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEV
ITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWG
GNLWNPSYCILTVSENTRAQIQKYIE
3D structure
PDB2xm3 DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
ChainF
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F T125 A127 Q130 T117 A119 Q122
BS02 dna F R14 Y16 V17 R6 Y8 V9
BS03 dna F Y132 I133 Y124 I125
BS04 dna F K29 Y30 K85 K88 G89 A90 A92 R93 F96 G109 N110 L111 W112 N113 P114 S115 Y116 K21 Y22 K77 K80 G81 A82 A84 R85 F88 G101 N102 L103 W104 N105 P106 S107 Y108
BS05 dna F Y30 R31 H67 W107 Y22 R23 H59 W99
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xm3, PDBe:2xm3, PDBj:2xm3
PDBsum2xm3
PubMed20890269
UniProtQ7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)

[Back to BioLiP]