Structure of PDB 2wu5 Chain F

Receptor sequence
>2wu5F (length=238) Species: 562 (Escherichia coli) [Search protein sequence]
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLS
FRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVI
RDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECI
LCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDA
FSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
3D structure
PDB2wu5 Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhd His71met Mutant
ChainF
Resolution2.803 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.3.5.1: succinate dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES F C55 R56 G58 C60 G61 D63 L73 C75 C55 R56 G58 C60 G61 D63 L73 C75
BS02 SF4 F C149 I150 L151 C152 A153 C155 A173 C216 C149 I150 L151 C152 A153 C155 A173 C216
BS03 F3S F C159 P172 C206 H207 S208 I209 M210 N211 C212 C159 P172 C206 H207 S208 I209 M210 N211 C212
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008177 succinate dehydrogenase (quinone) activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0009060 aerobic respiration
GO:0019646 aerobic electron transport chain
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wu5, PDBe:2wu5, PDBj:2wu5
PDBsum2wu5
PubMed
UniProtP07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit (Gene Name=sdhB)

[Back to BioLiP]