Structure of PDB 2vpw Chain F

Receptor sequence

>2vpwF (length=193) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MPRYAMAIDLSLCVGCAACAVACKMENEVPPGVFNLWIREREVGEYPNLV
VEFRPEQCLHCENPPCVPVCPTGASYQTKDGLVLVDPKKCIACGACIAAC
PYDARYLHPAGYVSKCTFCAHRLEKGKVPACVETCPTYCRTFGDLEDPES
PVAKALKAAERVDVLRPEQGTRPKLFYLNAPSKKGLTRESEVH

3D structure

PDB

2vpw Molecular Mechanism of Energy Conservation in Polysulfide Respiration.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	F	E189 S190	E189 S190
BS02	SF4	F	C13 G15 C16 C19 I38 P55 C135 C139 R140	C13 G15 C16 C19 I38 P55 C135 C139 R140
BS03	SF4	F	C23 N27 L36 Q57 C116 F118 C119 P129 A130 C131	C23 N27 L36 Q57 C116 F118 C119 P129 A130 C131
BS04	SF4	F	C58 L59 H60 C61 P65 C66 V83 C100 P101 Y102 R105	C58 L59 H60 C61 P65 C66 V83 C100 P101 Y102 R105
BS05	SF4	F	C70 P71 C90 I91 A92 C93 G94 C96 V113	C70 P71 C90 I91 A92 C93 G94 C96 V113

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0046872	metal ion binding
GO:0051539	4 iron, 4 sulfur cluster binding

View graph for
Molecular Function

External links

PDB	RCSB:2vpw, PDBe:2vpw, PDBj:2vpw
PDBsum	2vpw
PubMed	18536726
UniProt	Q72LA5

[Back to BioLiP]