Structure of PDB 2uxc Chain F

Receptor sequence
>2uxcF (length=101) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAY
PIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLAN
A
3D structure
PDB2uxc Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R2 Y4 Y50 K54 V72 N73 R87 V90 V91 K92 R2 Y4 Y50 K54 V72 N73 R87 V90 V91 K92
BS02 MG F R80 R82 V85 R80 R82 V85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2uxc, PDBe:2uxc, PDBj:2uxc
PDBsum2uxc
PubMed17416634
UniProtQ5SLP8|RS6_THET8 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]