Structure of PDB 2qqp Chain F |
>2qqpF (length=67) Species: 1289469 (Providence virus Helicoverpa zea /United States/vFLM1/-) [Search protein sequence] |
FAGTVSALASIGLGLLGKSSATPSVIKGIAQQAVGAVQANPGILEGAVKA IGSVGARLVGSIKARRA |
|
PDB | 2qqp Evolution in action: N and C termini of subunits in related T = 4 viruses exchange roles as molecular switches. |
Chain | F |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
K605 R613 R621 |
K49 R57 R65 |
|
|
|