Structure of PDB 2pg1 Chain F

Receptor sequence
>2pg1F (length=103) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKP
YKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFG
LAV
3D structure
PDB2pg1 Structural and thermodynamic characterization of a cytoplasmic dynein light chain-intermediate chain complex
ChainF
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F G72 G74 L75 H76 T77 A78 S79 S80 C81 Y82 W83 N84 N85 R94 Y101 I103 G64 G66 L67 H68 T69 A70 S71 S72 C73 Y74 W75 N76 N77 R86 Y93 I95
BS02 peptide F H34 N38 L49 H26 N30 L41
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0007018 microtubule-based movement
GO:0007286 spermatid development
GO:0008090 retrograde axonal transport
GO:0008340 determination of adult lifespan
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pg1, PDBe:2pg1, PDBj:2pg1
PDBsum2pg1
PubMed17551010
UniProtQ94524|DYLT_DROME Dynein light chain Tctex-type (Gene Name=Dlc90F)

[Back to BioLiP]