Structure of PDB 2mf1 Chain F |
>2mf1F (length=59) Species: 220664 (Pseudomonas protegens Pf-5) [Search protein sequence] |
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR IQAGLTAPD |
|
PDB | 2mf1 Structural basis of the non-coding RNA RsmZ acting as a protein sponge. |
Chain | F |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
M1 L2 I3 T5 K7 |
M1 L2 I3 T5 K7 |
|
|
|
|