Structure of PDB 2j4j Chain F

Receptor sequence

>2j4jF (length=226) Species: 273057 (Saccharolobus solfataricus P2)

MNIILKISGKFFDEDNVDNLIVLRQSIKELADNGFRVGIVTGGGSTARRY
IKLAREIGIGEAYLDLLGIWASRLNAYLVMFSLQDLAYMHVPQSLEEFIQ
DWSHGKVVVTGGFQPGQSTAAVAALVAEASSSKTLVVATNVDGVYEKDPR
IYADVKLIPHLTTQDLRKILEGSQSVQAGTYELLDPLAIKIVERSKIRVI
VMNYRKLNRIIDILKGEEVSSIIEPV

3D structure

• PDB: 2j4j Structural and Enzymatic Investigation of the Sulfolobus Solfataricus Uridylate Kinase Shows Competitive Utp Inhibition and the Lack of GTP Stimulation
• Chain: F
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.22: UMP kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	4TC	F	K6 S8 G9 K10 G42 G43 G44 R48 D65 G68 I69 G112 Q114 Q117 S118 T119 T139 N140 V141 V144 Y145 D148 P149 R150 A178 G179 Y181	K6 S8 G9 K10 G42 G43 G44 R48 D65 G68 I69 G112 Q114 Q117 S118 T119 T139 N140 V141 V144 Y145 D148 P149 R150 A178 G179 Y181
BS02	MG	F	R48 T180 Y181	R48 T180 Y181

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0009041 UMP/dUMP kinase activity
• GO:0016301 kinase activity
• GO:0033862 UMP kinase activity

Biological Process

• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006225 UDP biosynthetic process
• GO:0016310 phosphorylation
• GO:0044210 'de novo' CTP biosynthetic process
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2j4j, PDBe:2j4j, PDBj:2j4j
• PDBsum: 2j4j
• PubMed: 17297917
• UniProt: Q97ZE2|PYRH_SACS2 Uridylate kinase (Gene Name=pyrH)