Structure of PDB 2ga4 Chain F |
>2ga4F (length=70) Species: 10730 (Escherichia phage 933W) [Search protein sequence] |
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVT IKSSTCESGSGFAEVQFNND |
|
PDB | 2ga4 Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7. |
Chain | F |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1PS |
F |
N14 D16 T18 W29 |
N14 D16 T18 W29 |
|
|
|
|