Structure of PDB 2g4n Chain F

Receptor sequence
>2g4nF (length=122) Species: 9913 (Bos taurus) [Search protein sequence]
EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEY
GLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVG
INYWLAHKALCSEKLDQWLCEK
3D structure
PDB2g4n On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
ChainF
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T33 N45 S47 E49 N56
Catalytic site (residue number reindexed from 1) T33 N45 S47 E49 N56
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA F K79 D82 D84 D87 D88 K79 D82 D84 D87 D88
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0004461 lactose synthase activity
GO:0005509 calcium ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0005989 lactose biosynthetic process
GO:0032355 response to estradiol
GO:0032570 response to progesterone
GO:1903494 response to dehydroepiandrosterone
GO:1903496 response to 11-deoxycorticosterone
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2g4n, PDBe:2g4n, PDBj:2g4n
PDBsum2g4n
PubMed17327674
UniProtP00711|LALBA_BOVIN Alpha-lactalbumin (Gene Name=LALBA)

[Back to BioLiP]