Structure of PDB 2ftk Chain F |
>2ftkF (length=119) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVL LDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHF AKPFDIDEIRDAVKKYLPL |
|
PDB | 2ftk The Crystal Structure of Beryllofluoride Spo0F in Complex with the Phosphotransferase Spo0B Represents a Phosphotransfer Pretransition State. |
Chain | F |
Resolution | 3.05 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
F |
D1011 X1054 K1056 |
D9 X52 K54 |
|
|
|
|