Structure of PDB 2e74 Chain F

Receptor sequence
>2e74F (length=32) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGA
3D structure
PDB2e74 Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
ChainF
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F L15 I16 G19 G23 L26 L27 L15 I16 G19 G23 L26 L27
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2e74, PDBe:2e74, PDBj:2e74
PDBsum2e74
PubMed17498743
UniProtP83796|PETM_MASLA Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]