Structure of PDB 2d3b Chain F

Receptor sequence

>2d3bF (length=353) Species: 4577 (Zea mays)

CLTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPK
WNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPI
PTNKRYSAAKIFSSPEVAAEEPWYGIEQEYTLLQKDTNWPLGWPIGGFPG
PQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQV
GPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNY
STESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADIN
TFSWGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTI
VWK

3D structure

• PDB: 2d3b Atomic Structure of Plant Glutamine Synthetase: A KEY ENZYME FOR PLANT PRODUCTIVITY
• Chain: F
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 6.3.1.2: glutamine synthetase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MSL	F	E131 E192 G245 G247 H249 R291 E297 R311 R332	E129 E190 G243 G245 H247 R289 E295 R309 R330
BS02	MN	F	E129 E199	E127 E197
BS03	MN	F	E129 H249 E330	E127 H247 E328
BS04	MN	F	E131 E192 E199	E129 E190 E197
BS05	ANP	F	W125 G127 E129 S187 E199 Q201 N251 Y252 S253 R311 R316 Y328 E330	W123 G125 E127 S185 E197 Q199 N249 Y250 S251 R309 R314 Y326 E328

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004356 glutamine synthetase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity

Biological Process

• GO:0006542 glutamine biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2d3b, PDBe:2d3b, PDBj:2d3b
• PDBsum: 2d3b
• PubMed: 16829528
• UniProt: P38561|GLNA3_MAIZE Glutamine synthetase root isozyme 3 (Gene Name=GLN4)