Structure of PDB 2c20 Chain F

Receptor sequence

>2c20F (length=329) Species: 198094 (Bacillus anthracis str. Ames)

NSILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEGAKFYNG
DLRDKAFLRDVFTQENIEAVMHFAADSLVGVSMEKPLQYYNNNVYGALCL
LEVMDEFKVDKFIFSSTAATYGEVDVDLITEETMTNPTNTYGETKLAIEK
MLHWYSQASNLRYKIFRYFNVAGATPNGIIGEDHRPETHLIPLVLQVALG
QREKIMMFGDDYNTPDGTCIRDYIHVEDLVAAHFLGLKDLQNGGESDFYN
LGNGNGFSVKEIVDAVREVTNHEIPAEVAPRRAGDPARLVASSQKAKEKL
GWDPRYVNVKTIIEHAWNWHQKQPNGYEK

3D structure

• PDB: 2c20 Crystal Structure of Udp-Glucose 4-Epimerase from Bacillus Anthracis at 2.7A Resolution
• Chain: F
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T118 A119 A120 Y142 K146 H185
• Catalytic site (residue number reindexed from 1): T117 A118 A119 Y141 K145 H184
• Enzyme Commision number: 5.1.3.2: UDP-glucose 4-epimerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	F	G8 G11 Y12 I13 D32 N33 T36 G37 D52 L53 F74 A75 A76 N93 S117 T118 Y142 K146 Y169 F170 N171 V172 H185	G7 G10 Y11 I12 D31 N32 T35 G36 D51 L52 F73 A74 A75 N92 S116 T117 Y141 K145 Y168 F169 N170 V171 H184
BS02	ZN	F	E183 H185 E188 H190	E182 H184 E187 H189

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003978 UDP-glucose 4-epimerase activity
• GO:0016853 isomerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006012 galactose metabolic process
• GO:0033499 galactose catabolic process via UDP-galactose

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2c20, PDBe:2c20, PDBj:2c20
• PDBsum: 2c20
• UniProt: A0A6L8PTV5