Structure of PDB 2bs3 Chain F

Receptor sequence

>2bs3F (length=254) Species: 844 (Wolinella succinogenes)

MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVST
ILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRK
FPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQ
PQTIGPVSSSFRMVSEWMWPLYLVLLFAVQLHGSVGLYRLAVKWGWFDGE
TPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDY
KRTH

3D structure

• PDB: 2bs3 Experimental Support for the E-Pathway Hypothesis of Coupled Transmembrane Electron and Proton Transfer in Dihemic Quinol:Fumarate Reductase
• Chain: F
• Resolution: 2.19 Å

Enzymatic activity

• Enzyme Commision number: 1.3.99.1: Deleted entry.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	F	Y250 T253 H254	Y250 T253 H254
BS02	HEM	F	Q30 S31 G34 L37 F90 H93 A94 A97 K100 F101 W126 G133 M136 F137 H182 G186 L190 K193	Q30 S31 G34 L37 F90 H93 A94 A97 K100 F101 W126 G133 M136 F137 H182 G186 L190 K193
BS03	HEM	F	F40 M41 H44 V48 H143 M147 S159 R162 Y172 L175 L176 G224 F228	F40 M41 H44 V48 H143 M147 S159 R162 Y172 L175 L176 G224 F228

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Biological Process

• GO:0006099 tricarboxylic acid cycle

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2bs3, PDBe:2bs3, PDBj:2bs3
• PDBsum: 2bs3
• PubMed: 16380425
• UniProt: P17413|FRDC_WOLSU Fumarate reductase cytochrome b subunit (Gene Name=frdC)